ARHGEF1 monoclonal antibody (M03), clone 4C4

• Catalog Number: orb2291761
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ARHGEF1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT
• Tested applications: ELISA, IF, WB
• Clone Number: 4C4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH34013.2

ARHGEF1 monoclonal antibody (M03), clone 4C4 Western Blot analysis of ARHGEF1 expression in K-562.

Detection limit for recombinant GST tagged ARHGEF1 is approximately 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to ARHGEF1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (36.41 KDa).