You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291761 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ARHGEF1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ARHGEF1 (AAH34013.2, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQLGGNSVPQPGCT |
Tested applications | ELISA, IF, WB |
Clone Number | 4C4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH34013.2 |
ARHGEF1 monoclonal antibody (M03), clone 4C4 Western Blot analysis of ARHGEF1 expression in K-562.
Detection limit for recombinant GST tagged ARHGEF1 is approximately 0.3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to ARHGEF1 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.41 KDa).