You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295855 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein. |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Human, Mouse |
Immunogen | ARHGDIA (NP_004300.1, 1 a.a. ~ 204 a.a) full-length human protein. |
Conjugation | Unconjugated |
Protein Sequence | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
NCBI | NP_004300.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in human kidney.
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in Jurkat.
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in mouse spleen.
Western Blot analysis of ARHGDIA expression in transfected 293T cell line by ARHGDIA MaxPab polyclonal antibody. Lane 1: ARHGDIA transfected lysate(23.20 KDa). Lane 2: Non-transfected lysate.