ARHGDIA monoclonal antibody (M02), clone 1G5-2F3

• Catalog Number: orb2295851
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ARHGDIA.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ARHGDIA (AAH16031, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
• Tested applications: ELISA, WB
• Clone Number: 1G5-2F3
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH16031

Western Blot detection against Immunogen (48.18 KDa).

ARHGDIA monoclonal antibody (M02), clone 1G5-2F3. Western Blot analysis of ARHGDIA expression in human ovarian cancer.

Detection limit for recombinant GST tagged ARHGDIA is approximately 0.3 ng/ml as a capture antibody.