You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295851 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant ARHGDIA. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ARHGDIA (AAH16031, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
Tested applications | ELISA, WB |
Clone Number | 1G5-2F3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH16031 |
Western Blot detection against Immunogen (48.18 KDa).
ARHGDIA monoclonal antibody (M02), clone 1G5-2F3. Western Blot analysis of ARHGDIA expression in human ovarian cancer.
Detection limit for recombinant GST tagged ARHGDIA is approximately 0.3 ng/ml as a capture antibody.