You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295856 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human ARHGDIA protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | No additive |
Immunogen | ARHGDIA (NP_004300.1, 1 a.a. ~ 204 a.a) full-length human protein. |
Protein Sequence | MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD |
Tested applications | IP, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004300.1 |
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in human kidney.
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in Jurkat.
ARHGDIA MaxPab rabbit polyclonal antibody. Western Blot analysis of ARHGDIA expression in mouse spleen.
Immunoprecipitation of ARHGDIA transfected lysate using anti-ARHGDIA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ARHGDIA purified MaxPab mouse polyclonal antibody (B02P) (orb2295857).
Western Blot analysis of ARHGDIA expression in transfected 293T cell line by ARHGDIA MaxPab polyclonal antibody. Lane 1: ARHGDIA transfected lysate(23.2 KDa). Lane 2: Non-transfected lysate.