You have no items in your shopping cart.
Cart summary
Item 1 of 1
AQP10 Rabbit Polyclonal Antibody
Catalog Number: orb581025
| Catalog Number | orb581025 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to AQP10 |
| Target | AQP10 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Rat, Yeast |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human AQP10 |
| Protein Sequence | Synthetic peptide located within the following region: VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK |
| UniProt ID | Q96PS8 |
| MW | 32kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | AQPA_HUMAN |
| Note | For research use only |
| NCBI | NP_536354 |
WB Suggested Anti-AQP10 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human kidney.
- Item 1 of 1
Anti-Aquaporin 10 Antibody [orb412142]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl - Item 1 of 1
AQP10 Rabbit Polyclonal Antibody [orb581024]
WB
Bovine, Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
