You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
APOM monoclonal antibody (M03), clone 1G9
Catalog Number: orb2290992
| Catalog Number | orb2290992 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a full-length recombinant APOM. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG1 Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | APOM (AAH20683, 23 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN |
| Tested applications | ELISA, WB |
| Clone Number | 1G9 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | AAH20683 |
Detection limit for recombinant GST tagged APOM is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (44 KDa).
