APOM monoclonal antibody (M01), clone 1F10

• Catalog Number: orb2290994
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant APOM.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: APOM (AAH20683, 23 a.a. ~ 188 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
• Tested applications: ELISA, WB
• Clone Number: 1F10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH20683

Detection limit for recombinant GST tagged APOM is approximately 0.3 ng/ml as a capture antibody.

Western Blot analysis of APOM expression in transfected 293T cell line by APOM monoclonal antibody (M01), clone 1F10. Lane 1: APOM transfected lysate(21.3 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of APOM over-expressed 293 cell line, cotransfected with APOM Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with APOM monoclonal antibody (M01), clone 1F10 (Cat # orb2290994). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (44 KDa).