APOA1 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295988
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human APOA1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: APOA1 (NP_000030.1, 1 a.a. ~ 267 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
• NCBI: NP_000030.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

APOA1 MaxPab polyclonal antibody. Western Blot analysis of APOA1 expression in human colon.

Western Blot analysis of APOA1 expression in transfected 293T cell line by APOA1 MaxPab polyclonal antibody. Lane 1: APOA1 transfected lysate(29.37 KDa). Lane 2: Non-transfected lysate.