APOA1 Protein, Bovine, Recombinant (His)

• Catalog Number: orb1979685
• Category: Proteins
• Description: Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. APOA1 Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.5 kDa and the accession number is P15497.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 29.5 kDa (predicted)
• UniProt ID: P15497
• Protein Sequence: DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ
• Expression System: P. pastoris (Yeast)
• Biological Origin: Bovine
• Biological Activity: Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. APOA1 Protein, Bovine, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 29.5 kDa and the accession number is P15497.
• Expression Region: 25-265 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.