You have no items in your shopping cart.
Cart summary
APOA1 Protein, Bovine, Recombinant (E. coli, His)
Catalog Number: orb1979686
| Catalog Number | orb1979686 |
|---|---|
| Category | Proteins |
| Description | Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. APOA1 Protein, Bovine, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.6 kDa and the accession number is P15497. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 31.6 kDa (predicted) |
| UniProt ID | P15497 |
| Protein Sequence | DDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASALGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKVQPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVETLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGLLPVLESLKVSILAAIDEASKKLNAQ |
| Expression System | E. coli |
| Biological Origin | Bovine |
| Biological Activity | Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. APOA1 Protein, Bovine, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 31.6 kDa and the accession number is P15497. |
| Expression Region | 25-265 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
