You have no items in your shopping cart.
Cart summary
Item 1 of 1
APLF Rabbit Polyclonal Antibody
Catalog Number: orb586209
Product Properties
| Catalog Number | orb586209 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to APLF |
| Target | APLF |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human APLF |
| Protein Sequence | Synthetic peptide located within the following region: NVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKEDEEKED |
| UniProt ID | Q8IW19 |
| MW | 57kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | APFL, PALF, Xip1, ZCCHH1, C2orf13 |
| Research Area | Molecular Biology |
| Note | For research use only |
| NCBI | NP_775816 |
Images
WB Suggested Anti-APLF Antibody, Titration: 1.0 ug/ml, Positive Control: PANC1 Whole Cell.
Similar Products
- Item 1 of 3
- Item 1 of 3
- Item 1 of 1
APLF (phospho Ser116) rabbit pAb [orb767978]
ELISA, IHC-P
Human, Mouse
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 1
- Item 1 of 1
Reviews
APLF Rabbit Polyclonal Antibody (orb586209)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review