APH1a Antibody

• Catalog Number: orb259598
• Category: Antibodies
• Description: APH1a Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 28996 MW
• UniProt ID: Q96BI3
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Gamma-secretase subunit APH-1A;APH-1a;Aph-1alpha;P
• Note: For research use only
• Application notes: WB: The detection limit for APH1a is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of APH1a using anti-APH1a antibody.Lane 1:Mouse Lung Tissue;2:Mouse Liver Tissue;3:SW620 Cell;4:SMMC Cell;5:Human Placenta Tissue.