You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| CAS Number | 252642-12-9 |
|---|---|
| MW | 4195.87 Da |
| Purity | > 95% by hplc |
| Formula | C184H297N69O43S |
| Protein Sequence | H-Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe-OH |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−, 252642-12-9, Apelin-36 (human), Apelin36 (human), LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Similar Products
−- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Apelin/APLN Rabbit Polyclonal Antibody [orb47968]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg Human APLN Recombinant Protein (N-His) [orb3233756]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
50 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days