Apbb2 Rabbit Polyclonal Antibody

• Catalog Number: orb582824
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Apbb2
• Target: Apbb2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: GQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSA
• MW: 77kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RGD1562438
• Research Area: Cell Biology, Epigenetics & Chromatin
• Note: For research use only
• NCBI: XP_223399
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-Apbb2 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Liver.