Ap4s1 Rabbit Polyclonal Antibody

SKU: orb581650

Description

Ap4s1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Ap4s1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ap4s1. This antibody reacts with Rat samples and is predicted to react with Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Yeast, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ap4s1
• Target: Ap4s1
• Protein Sequence: Synthetic peptide located within the following region: VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI
• Molecular Weight: 15kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

Gene Symbol

Ap4s1

UniProt

F1M5X2

RefSeq (Protein):NP_001124471