AP2M1 Rabbit Polyclonal Antibody

SKU: orb588067

Description

AP2M1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of AP2M1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the Middle region of Rat AP2M1. This antibody reacts with Rat samples and is predicted to react with Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Rat
• Predicted Reactivity: Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the Middle region of Rat AP2M1
• Target: AP2M1
• Protein Sequence: Synthetic peptide located within the following region: YLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRL
• Molecular Weight: 47 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

mu2, Ap50, Clapm1

Quick Database Links

Gene Symbol

AP2M1

UniProt

P84092

RefSeq (Protein):NP_446289.1