AP1M2 Rabbit Polyclonal Antibody

• Catalog Number: orb581563
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AP1M2
• Target: AP1M2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AP1M2
• Protein Sequence: Synthetic peptide located within the following region: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL
• UniProt ID: Q9Y6Q5
• MW: 48kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: mu2, MU1B, MU-1B, HSMU1B, AP1-mu2
• Research Area: Signal Transduction
• Note: For research use only
• NCBI: NP_005489
• Expiration Date: 12 months from date of receipt.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. AP1M2 is strongly supported by BioGPS gene expression data to be expressed in HepG2.

WB Suggested Anti-AP1M2 Antibody Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate. AP1M2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.