ANXA7 Rabbit Polyclonal Antibody

SKU: orb576018

Description

Rabbit polyclonal antibody to ANXA7

Research Area

Cardiovascular Research, Cell Biology, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA7
• Target: ANXA7
• Protein Sequence: Synthetic peptide located within the following region: MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
• Molecular Weight: 51kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SNX, ANX7, SYNEXIN

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-ANXA7 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

ANXA7

UniProt

Q5T0M6

RefSeq (Protein):NP_001147