You have no items in your shopping cart.
Cart summary
Item 1 of 1
C5orf39 Rabbit Polyclonal Antibody
Catalog Number: orb325917
| Catalog Number | orb325917 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to ANXA2R |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C5orf39 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 22kDa |
| Target | ANXA2R |
| UniProt ID | Q3ZCQ2 |
| Protein Sequence | Synthetic peptide located within the following region: EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS |
| NCBI | NP_001014301 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti AX2R antibody, anti AXIIR antibody, anti C5or Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-C5orf39 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Placenta.
- Item 1 of 1
AX2R Rabbit Polyclonal Antibody [orb101772]
ELISA, IF, IHC-Fr, IHC-P
Human
Mouse
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl - Item 1 of 1
