ANXA2 Rabbit Polyclonal Antibody

SKU: orb329874

Description

ANXA2 Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of ANXA2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human ANXA2. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ANXA2
• Target: ANXA2
• Protein Sequence: Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
• Molecular Weight: 37kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti P36 antibody, anti ANX2 antibody, anti LIP2 antibody, anti LPC2 antibody, anti CAL1H antibody, anti LPC2D antibody, anti ANX2L4 antibody, anti PAP-IV antibody

Quick Database Links

Gene Symbol

ANXA2

UniProt

Q8TBV2

RefSeq (Protein):NP_004030