Anti-STX6

• Catalog Number: orb334970
• Category: Antibodies
• Description: Goat polyclonal to Syntaxin-6 – trans-Golgi and endosome marker. This trans-Golgi and endosome protein regulates membrane trafficking by partnering with a variety of other SNARE proteins. This protein is also involved in the regulation of neutrophil exocytosis, granule secretion and GLUT4 trafficking.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli.. Antigen Sequence: MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDAT
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:500-1:2,000
• Conjugation: Unconjugated
• Target: Syntaxin 6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: Syn6 and STX6 antibody.
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of staining of GFP-STX6 NT, GFP-STX6 NT and GFP-STX6 lysates using STX6 antibody