You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb334970 |
---|---|
Category | Antibodies |
Description | Goat polyclonal to Syntaxin-6 – trans-Golgi and endosome marker. This trans-Golgi and endosome protein regulates membrane trafficking by partnering with a variety of other SNARE proteins. This protein is also involved in the regulation of neutrophil exocytosis, granule secretion and GLUT4 trafficking. |
Species/Host | Goat |
Clonality | Polyclonal |
Tested applications | WB |
Reactivity | Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep |
Isotype | IgG |
Immunogen | Antigen: Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli.. Antigen Sequence: MSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDAT |
Antibody Type | Primary Antibody |
Concentration | 1 mg/ml |
Dilution range | WB:1:500-1:2,000 |
Conjugation | Unconjugated |
Target | Syntaxin 6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | PBS, 20% glycerol and 0.05% sodium azide |
Alternative names | Syn6 and STX6 antibody. Read more... |
Note | For research use only |
Application notes | The antibody solution should be gently mixed before use. |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of staining of GFP-STX6 NT, GFP-STX6 NT and GFP-STX6 lysates using STX6 antibody
ELISA, WB | |
Canine, Human, Mouse, Rat | |
Goat | |
Polyclonal | |
Unconjugated |