Anti-ERBB2

• Catalog Number: orb334988
• Category: Antibodies
• Description: Goat polyclonal antibody to ERBB2. This protein is a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases containing a single transmembrane domain and has an approximate molecular weight of 185 kDa. ERBB2 contains no ligand binding domain and interacts with other EGF receptor family members to form a heterodimer, stabilize ligand binding, and enhance kinase-mediated downstream signalling. It has been shown to be involved in embryonic development and cancer progression.
• Species/Host: Goat
• Clonality: Polyclonal
• Tested applications: IHC-Fr, IHC-P, WB
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli.. Antigen Sequence: MPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
• Antibody Type: Primary Antibody
• Concentration: 1 mg/ml
• Dilution range: WB:1:500-1:5,000, IHC-P:1:250-1:1,000, IHC-F:1:250-1:1,000
• Conjugation: Unconjugated
• Target: Erb-b2 receptor tyrosine kinase
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Alternative names: CD340, erb-b2 receptor tyrosine kinase 2, HER2, HE
• Note: For research use only
• Application notes: The antibody solution should be gently mixed before use.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of staining of SKOV using ERBB2 antibody