Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Calcitonin/Calca Rabbit Polyclonal Antibody

SKU: orb443096

Description

The Calcitonin/Calca Rabbit Polyclonal Antibody is an unconjugated antibody raised in rabbit. It is immunogen affinity purified and suitable for use in IHC applications. This antibody targets the Calcitonin in Human, Mouse, and Rat samples.

Research Area

Cardiovascular Research, Cell Biology, Neuroscience

Images & Validation

Tested ApplicationsIHC
Dilution RangeImmunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
ReactivityHuman, Mouse, Rat

Related Conjugates & Formulations

Key Properties

Antibody TypePrimary Antibody
HostRabbit
ClonalityPolyclonal
IsotypeRabbit IgG
ImmunogenA synthetic peptide corresponding to a sequence of mouse Calcitonin: CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP, which shares 90.6% and 96.9% amino acid (aa) sequence identity with human and rat Calcitonin, respectively.
TargetCalcitonin
Molecular WeightCalculated molecular weight: 15.1 kDa
PurificationImmunogen affinity purified.
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearanceLyophilized
Buffer/PreservativesEach vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

calcitonin related polypeptide alpha; CALC1; CGRP; CGRP-I; CGRP-alpha; CGRP1; CT; KC; PCT; CALCA

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

IHC
Immunohistochemistry
View Protocol

Available Sizes

Select a size below

100 μg
$ 470.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-4 weeks
Bulk Enquiry