Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Calcitonin/Calca Rabbit Polyclonal Antibody

SKU: orb443096

Description

Anti-Calcitonin/Calca Antibody. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat.

Research Area

Cardiovascular Research, Cell Biology, Neuroscience

Images & Validation

Tested ApplicationsIHC
Dilution RangeImmunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
ReactivityHuman, Mouse, Rat

Key Properties

Antibody TypePrimary Antibody
HostRabbit
ClonalityPolyclonal
IsotypeRabbit IgG
ImmunogenA synthetic peptide corresponding to a sequence of mouse Calcitonin: CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP, which shares 90.6% and 96.9% amino acid (aa) sequence identity with human and rat Calcitonin, respectively.
TargetCalcitonin
Molecular WeightCalculated molecular weight: 15.1 kDa
PurificationImmunogen affinity purified.
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearanceLyophilized
Buffer/PreservativesEach vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

calcitonin related polypeptide alpha; CALC1; CGRP; CGRP-I; CGRP-alpha; CGRP1; CT; KC; PCT; CALCA

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Protocol Information

IHC
Immunohistochemistry
View Protocol

Available Sizes

Select a size below

100 μg
$ 470.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-4 weeks
Bulk Enquiry