ANKRA2 Rabbit Polyclonal Antibody

• Catalog Number: orb588210
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ANKRA2
• Target: ANKRA2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen for Anti-ANKRA2 antibody is: synthetic peptide directed towards the N-terminal region of Human ANRA2
• Protein Sequence: Synthetic peptide located within the following region: SRFVKSLNEEDSKNIQDQVNSDLEVASVLFKAECNIHTSPSPGIQVRHVY
• UniProt ID: Q9H9E1
• MW: 34 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ANKRA
• Research Area: Cell Biology, Epigenetics & Chromatin, Stem Cell &
• Note: For research use only
• NCBI: NP_075526.1
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-ANRA2 antibody Titration: 1 ug/ml, Sample Type: Human MCF7 Whole Cell.