You have no items in your shopping cart.
Cart summary
Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar)
Catalog Number: orb1977412
| Catalog Number | orb1977412 |
|---|---|
| Category | Proteins |
| Description | Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 29.9 kDa and the accession number is Q3TMQ6. |
| Tag | N-6xHis-SUMOstar |
| Purity | 98.00% |
| MW | 29.9 kDa (predicted) |
| UniProt ID | Q3TMQ6 |
| Protein Sequence | QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Mouse |
| Biological Activity | Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro). Angiogenin-4 Protein, Mouse, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 29.9 kDa and the accession number is Q3TMQ6. |
| Expression Region | 25-144 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
