ANGEL1 Rabbit Polyclonal Antibody

SKU: orb1262441

Description

ANGEL1 Rabbit Polyclonal Antibody

Research Area

Cell Biology

Images & Validation

• Tested Applications: FC, IHC-P, WB
• Dilution Range: WB: 1:1000 ; IHC-P : 1:50 -100; FACS: 1:10 - 50
• Reactivity: Human, Mouse

Key Properties

• Antibody Type: Primary Antibody
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: Rabbit Ig
• Immunogen: KLH conjugated synthetic peptide between 597-624 amino acids ( region: SPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITD ) from the C-terminal region of human ANGEL1.
• Target: ANGEL1
• Molecular Weight: 75 kDa
• Purification: This antibody is purified through a protein A column, followed by peptide affinity purification.
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Liquid
• Buffer/Preservatives: Supplied in PBS with 0.09% (W/V) sodium azide.
• Concentration: batch dependent
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Protein angel homolog 1, ANGEL1, KIAA0759

Western blot analysis of ANGEL1 Antibody in mouse testis tissue lysates (35 ug/lane)

Formalin-fixed and paraffin-embedded human testis tissue reacted with ANGEL1 Antibody, which was peroxidase-conjugated to the secondary antibody, followed by DAB staining.

Flow cytometric analysis of Jurkat cells (right histogram) compared to a negative control cell (left histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

Quick Database Links

Gene Symbol

ANGEL1

UniProt

Q9UNK9

RefSeq:Q9UNK9