You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693245 |
---|---|
Category | Proteins |
Description | β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease. |
Target | Amyloid-β |
Purity | ≥95% |
Protein Sequence | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG |
MW | 4035.5 |
CAS Number | 186359-66-0 |
Formula | C180H273N49O55S |
Note | For research use only |