AMPK beta 2/PRKAB2 Antibody

• Catalog Number: orb316602
• Category: Antibodies
• Description: AMPK beta 2/PRKAB2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Bovine
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 30302 MW
• UniProt ID: O43741
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: 5'-AMP-activated protein kinase subunit beta-2;AMP
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A431 cells using anti-AMPK beta 2 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of AMPK beta 2 using anti-AMPK beta 2 antibody.Lane 1:Rat Brain Tissue;2:Rat Skeletal Muscle Tissue;3:PANC Cell.

IF analysis of AMPK beta 2 using anti-AMPK beta 2 antibody. AMPK beta 2 was detected in immunocytochemical section of A431 cells.

IHC analysis of AMPK beta 2 using anti-AMPK beta 2 antibody. AMPK beta 2 was detected in a paraffin-embedded section of human lung cancer tissue.

IHC analysis of AMPK beta 2 using anti-AMPK beta 2 antibody. AMPK beta 2 was detected in a paraffin-embedded section of rat intestine tissue.

IHC analysis of AMPK beta 2 using anti-AMPK beta 2 antibody. AMPK beta 2 was detected in a paraffin-embedded section of mouse intestine tissue.