AMPK beta 2 PRKAB2 Antibody (monoclonal, 6G1)

• Catalog Number: orb443138
• Category: Antibodies
• Description: AMPK beta 2 PRKAB2 Antibody (monoclonal, 6G1)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6G1
• Tested applications: FC, ICC, IHC, WB
• Reactivity: Human
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 2 (56-89aa DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry, 0.5-1μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 34 kDa
• UniProt ID: O43741
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: 5'-AMP-activated protein kinase subunit beta-2; AM
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of PC-3 cells using anti-AMPK beta 2 antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of AMPK beta 2 using anti-AMPK beta 2 antibody.Lane 1:human HeLa Cell;2:human placenta Tissue;3:human 293T Cell;4:human A549 Cell;5:human A375 Cell;6:human A431 Cell;7:human U20S Cell;8:human K562 Cell.