You have no items in your shopping cart.
Cart summary
Alpha-toxin Amm8 Protein, Androctonus mauritanicus, Recombinant (His & Myc)
Catalog Number: orb1979855
| Catalog Number | orb1979855 |
|---|---|
| Category | Proteins |
| Description | Alpha-toxin Amm8 Protein, Androctonus mauritanicus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 11.3 kDa and the accession number is Q7YXD3. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| Protein Sequence | LKDGYIVNDINCTYFCGRNAYCNELCIKLKGESGYCQWASPYGNSCYCYKLPDHVRTKGPGRCND |
| UniProt ID | Q7YXD3 |
| MW | 11.3 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | Baculovirus Insect Cells |
| Biological Origin | Androctonus mauritanicus |
| Biological Activity | Alpha-toxin Amm8 Protein, Androctonus mauritanicus, Recombinant (His & Myc) is expressed in Baculovirus insect cells with N-10xHis and C-Myc tag. The predicted molecular weight is 11.3 kDa and the accession number is Q7YXD3. |
| Expression Region | 20-84 aa |
| Storage | -20°C |
| Note | For research use only |
