ALG5 Rabbit Polyclonal Antibody

• Catalog Number: orb326404
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALG5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: ALG5
• UniProt ID: Q9Y673
• Protein Sequence: Synthetic peptide located within the following region: ALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVIT
• NCBI: NP_037470
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti RP11-421P11.2 antibody, anti bA421P11.2 antib
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-ALG5 Antibody, Titration: 1.0 ug/mL, Positive Control: COLO205 Whole Cell, ALG5 is supported by BioGPS gene expression data to be expressed in COLO205.