ALDOA monoclonal antibody (M03), clone 2E6

• Catalog Number: orb2296176
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ALDOA.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ALDOA (AAH10660.1, 21 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: HRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFP
• Tested applications: ELISA, WB
• Clone Number: 2E6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH10660.1

ALDOA monoclonal antibody (M03), clone 2E6. Western Blot analysis of ALDOA expression in HepG2.

ALDOA monoclonal antibody (M03), clone 2E6. Western Blot analysis of ALDOA expression in NIH/3T3.

Western Blot detection against Immunogen (33.99 KDa).