ALDH3A1 Rabbit Polyclonal Antibody

• Catalog Number: orb331065
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ALDH3A1
• Target: ALDH3A1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALDH3A1
• Protein Sequence: Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI
• UniProt ID: P30838
• MW: 50kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ALDH3 antibody, anti ALDHIII antibody, anti M
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_000682
• Expiration Date: 12 months from date of receipt.

ALDH3A1 antibody - N-terminal region (orb331065) validated by WB using Fetal Muscle cell lysate at 1 ug/ml.

Sample Type: Human Cornea, dilution: 1:200.

WB Suggested Anti-ALDH3A1 Antibody, Positive Control: Lane 1: 30 ug human primary hepatocytes, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:5000.