ALDH1B1 Antibody

• Catalog Number: orb381039
• Category: Antibodies
• Description: ALDH1B1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Monkey, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Monkey, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat, By Heat Immunocytochemistry/Immunofluorescence, 5μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 57206 MW
• UniProt ID: P30837
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Aldehyde dehydrogenase X, mitochondrial;1.2.1.3;Al
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HEL cells using anti-ALDH1B1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis of ALDH1B1 using anti-ALDH1B1 antibody.Lane 1:human HepG2 cell; 2:human K562 cell; 3:human A431 cell; 4:human A549 cell; 5:human U20S cell; 6:human HeLa cell; 7:monkey COS-7 cell.

WB analysis of ALDH1B1 using anti-ALDH1B1 antibody.Lane 1:rat liver tissue; 2:rat testis tissue; 3:rat RH35 cell; 4:mouse brain tissue; 5:mouse liver tissue.

IF analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in an immunocytochemical section of A431 cells.

IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human colon cancer tissue.

IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human colonic adenocarcinoma tissue.

IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human endometrial adenocarcinoma tissue.

IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human hepatocellular carcinoma tissue.

IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of human laryngeal squamous cell carcinoma tissue.

IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of mouse colon tissue.

IHC analysis of ALDH1B1 using anti-ALDH1B1 antibody. ALDH1B1 was detected in a paraffin-embedded section of rat colon tissue.