You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
ALAS2 monoclonal antibody (M02), clone 4D8
Catalog Number: orb2296215
| Catalog Number | orb2296215 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant ALAS2. |
| Clonality | Monoclonal |
| Species/Host | Mouse |
| Isotype | IgG2a Kappa |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Immunogen | ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK |
| Tested applications | ELISA, WB |
| Clone Number | 4D8 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_000023 |
Detection limit for recombinant GST tagged ALAS2 is approximately 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa).
