ALAS2 monoclonal antibody (M01), clone 6C1

• Catalog Number: orb2296216
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ALAS2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK
• Tested applications: ELISA, WB
• Clone Number: 6C1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000023

ALAS2 monoclonal antibody (M01), clone 6C1. Western Blot analysis of ALAS2 expression in Raw 264.7.

Detection limit for recombinant GST tagged ALAS2 is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of ALAS2 expression in transfected 293T cell line by ALAS2 monoclonal antibody (M01), clone 6C1. Lane 1: ALAS2 transfected lysate(64 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).