ALAS2 monoclonal antibody (M01), clone 6C1

• Catalog Number: orb2296216
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ALAS2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 6C1
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: ALAS2 (NP_000023, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MVTAAMLLQCCPVLARGPTSLLGKVVKTHQFLFGIGRCPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQKAAPEVQEDVKAFK
• NCBI: NP_000023
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ALAS2 monoclonal antibody (M01), clone 6C1. Western Blot analysis of ALAS2 expression in Raw 264.7.

Detection limit for recombinant GST tagged ALAS2 is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of ALAS2 expression in transfected 293T cell line by ALAS2 monoclonal antibody (M01), clone 6C1. Lane 1: ALAS2 transfected lysate(64 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).