ALAS1 monoclonal antibody (M03), clone 2D5

• Catalog Number: orb2296217
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ALAS1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2D5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ALAS1 (NP_000679, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
• NCBI: NP_000679
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ALAS1 monoclonal antibody (M03), clone 2D5. Western Blot analysis of ALAS1 expression in COLO 320 HSR.

Detection limit for recombinant GST tagged ALAS1 is 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.52 KDa).