ALAS1 monoclonal antibody (M01), clone 3G10

• Catalog Number: orb2296218
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ALAS1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ALAS1 (NP_000679, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLP
• Tested applications: ELISA, WB
• Clone Number: 3G10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000679

ALAS1 monoclonal antibody (M01), clone 3G10 Western Blot analysis of ALAS1 expression in JAR.

Detection limit for recombinant GST tagged ALAS1 is approximately 0.1 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.52 KDa).