AKR1C3 Rabbit Polyclonal Antibody

SKU: orb331134

Description

Rabbit polyclonal antibody to AKR1C3

Research Area

Disease Biomarkers, Pharmacology & Drug Discovery, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: AKR1C3
• Protein Sequence: Synthetic peptide located within the following region: PALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCT
• Molecular Weight: 36kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DD3 antibody, anti DDX antibody, anti HA1753 antibody, anti HAKRB antibody, anti HAKRe antibody, anti HSD17B5 antibody, anti KIAA0119 antibody, anti hluPGFS antibody

Rabbit Anti-AKR1C3 Antibody, Catalog Number: orb331134, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-AKR1C3 Antibody, Titration: 1.0 ug/ml, Positive Control: COLO205 Whole Cell, AKR1C3 is supported by BioGPS gene expression data to be expressed in COLO205.

Quick Database Links

Gene Symbol

AKR1C3

UniProt

P42330

RefSeq (Protein):NP_003730