You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290956 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant AKR1B10. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 1A6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_064695 |
AKR1B10 monoclonal antibody (M01), clone 1A6 Western Blot analysis of AKR1B10 expression in HepG2.
Detection limit for recombinant GST tagged AKR1B10 is approximately 0.03 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to AKR1B10 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Western Blot analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody (M01), clone 1A6. Lane 1: AKR1B10 transfected lysate(36 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (33.22 KDa).