AKR1B10 Rabbit Polyclonal Antibody

• Catalog Number: orb330244
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AKR1B10
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AKR1B10
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: AKR1B10
• UniProt ID: O60218
• Protein Sequence: Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL
• NCBI: NP_064695
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti AKR1B11 antibody, anti AKR1B12 antibody, anti
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-AKR1B10 Antibody Titration: 1.25 ug/mL, Positive Control: A549 cell lysate, AKR1B10 is supported by BioGPS gene expression data to be expressed in A549.