You have no items in your shopping cart.
Cart summary
AIMP2 Protein, Human, Recombinant (His)
Catalog Number: orb1978986
| Catalog Number | orb1978986 |
|---|---|
| Category | Proteins |
| Description | AIMP2 Protein, Human, Recombinant (His) is expressed in E. coli. |
| Tag | N-6xHis |
| Protein Sequence | MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK |
| UniProt ID | Q13155 |
| MW | 39.3 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 1-320 aa |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
EEF1E1 Protein, Human, Recombinant (His) [orb1955747]
21.6 kDa (predicted); 19-24 kDa (reducing conditions)
100 μgRecombinant Human AIMP2 Protein, N-His [orb2834068]
>90% as determined by SDS-PAGE.
24.71 kDa
100 μg, 20 μg, 50 μgRecombinant Human AIMP2 Protein, N-His [orb2966054]
>90% as determined by SDS-PAGE.
24.71 kDa
1 mg, 100 μg, 50 μg
