You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1176977 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to AHSG |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human, Rat |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids. |
Dilution range | Western blot: 0.1-0.5μg/ml. Immunohistochemistry(Paraffin-embedded Section): 0.5-1μg/ml. ELISA: 0.1-0.5μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
Target | AHSG |
Storage | At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing |
Buffer/Preservatives | Antibody is lyophilized with 5 mg rAlbumin, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request |
Alternative names | 59 kDa bone sialic acid-containing protein antibod Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ELISA, IF, IHC | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating