AFM Rabbit Polyclonal Antibody

• Catalog Number: orb574827
• Category: Antibodies
• Description: Rabbit polyclonal antibody to AFM
• Target: AFM
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Guinea pig
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AFM
• Protein Sequence: Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR
• UniProt ID: P43652
• MW: 69kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ALF, ALB2, ALBA
• Research Area: Signal Transduction, Stem Cell & Developmental Bio
• Note: For research use only
• NCBI: NP_001124

Positive control (+): Human Placenta (PL), Negative control (-): Human Liver (LI), Antibody concentration: 1 ug/ml.

WB Suggested Anti-AFM Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.