AFDN Rabbit Polyclonal Antibody

• Catalog Number: orb329765
• Category: Antibodies
• Description: Rabbit polyclonal antibody to MLLT4
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MLLT4
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 74kDa
• Target: AFDN
• UniProt ID: P55196
• Protein Sequence: Synthetic peptide located within the following region: GVIQNFKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAE
• NCBI: EAW47480
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti RP3-470B24.4 antibody, anti AF-6 antibody, an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-MLLT4 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, MLLT4 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells.