You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb591394 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to ADRM1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Human |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 44 kDa |
Target | ADRM1 |
UniProt ID | Q16186 |
Protein Sequence | Synthetic peptide located within the following region: LMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDM |
NCBI | NP_001268366.1 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | ARM1, ARM-1, GP110, PSMD16 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
ELISA, FC, ICC, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Guinea pig, Human, Mouse, Rat | |
Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ICC, IHC-Fr, IHC-P, IP, WB | |
Human | |
Rabbit | |
Monoclonal | |
Unconjugated |
Filter by Rating