ADRM1 Rabbit Polyclonal Antibody

• Catalog Number: orb331037
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ADRM1
• Target: ADRM1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1
• Protein Sequence: Synthetic peptide located within the following region: QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE
• UniProt ID: Q16186
• MW: 40kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ARM1 antibody, anti GP110 antibody, anti MGC2
• Note: For research use only
• NCBI: NP_783163

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 1 ug/ml.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. ADRM1 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. ADRM1 is supported by BioGPS gene expression data to be expressed in HeLa.

WB Suggested Anti-ADRM1 antibody, Titration: 1 ug/ml, Positive Control: HeLa cells and cytosol from male mouse liver.