ADM2 Rabbit Polyclonal Antibody

• Catalog Number: orb586050
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ADM2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC
• Predicted Reactivity: Bovine, Equine, Human, Mouse, Porcine, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 16 kDa
• Target: ADM2
• UniProt ID: Q7Z4H4
• Protein Sequence: Synthetic peptide located within the following region: GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS
• NCBI: NP_079142
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: AM2, dJ579N16.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-ADM2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Pancreas, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.