Adcyap1r1 Rabbit Polyclonal Antibody

• Catalog Number: orb584518
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Adcyap1r1
• Target: Adcyap1r1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: GIIIILVQKLQSPDMGGNESSIYFSCVQKCYCKPQRAQQHSCKMSELSTI
• UniProt ID: P32215
• MW: 54kDa
• Tested applications: IHC, IHC-Fr, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PAC1-R, PACAPR1, PACAP-R1, PACAPR1A, PACAP-R1A
• Note: For research use only
• NCBI: NP_598195

WB Suggested Anti-Adcyap1r1 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Brain.