ADARB1 Rabbit Polyclonal Antibody

• Catalog Number: orb577540
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ADARB1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ADARB1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 77kDa
• Target: ADARB1
• UniProt ID: Q4AE79
• Protein Sequence: Synthetic peptide located within the following region: QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI
• NCBI: NP_001103
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: RED1, ADAR2, DRABA2, DRADA2, NEDHYMS
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

ADARB1 antibody - N-terminal region (orb577540) validated by WB using Mouse brains at 1:1000.

WB Suggested Anti-ADARB1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: HepG2 cell lysate.